Sign In | Join Free | My
Search by Category
Wholesale Marketplace
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type


    bio diagnostics

    All bio diagnostics wholesalers & bio diagnostics manufacturers come from members. We doesn't provide bio diagnostics products or service, please contact them directly and verify their companies info carefully.

    Total 2263 products from bio diagnostics Manufactures & Suppliers
    Buy cheap AH - Q5 Weak Magnetic Resonance Quantum Lysine Body Health Analyzer Bio - Electric product

    Place of Origin:China

    Model Number:AH-Q5

    ...AH - Q5 Weak Magnetic Resonance Quantum Lysine Body Health Analyzer Bio - Electric Quick Detail: spanish quantum analyzer Biggest manufacturer in China English/French/Malaysia/Korean/Rome ...

    Shenzhen Huge Creation Technology Limited
    Verified Supplier


    Buy cheap Human use Handheld Palm Ultrasound Scanner Ultrasonic Diagnostic Machine with 7 Inch Screen  1 Probe Connector product

    Brand Name:BIO

    Model Number:3000M+

    Place of Origin:China

    ...Human use Handheld Palm Ultrasound Scanner Ultrasonic Diagnostic Machine with 7 Inch Screen 1 Probe Connector Brief Digital Handheld Ultrasonic Diagnostic System 3000M+, a full digital PALM TYPE ultrasound/ultrasonic scanner with extremely compact ...

    Wuxi Biomedical Technology Co., Ltd.
    Verified Supplier


    Buy cheap 100VA Power Output Lipo Laser Slimming Machine On Board Diagnostics Safety product

    Brand Name:BEIR

    Model Number:BR103

    Place of Origin:Guangzhou China

    ...100VA Power Output Lipo Laser Fat Reduction Machine On Board Diagnostics Safety Applications: Intensive physical laser lipolysis to remove cellulite or fat Body or arms Excess ...

    Guangzhou Beir Electronic Technology Co., Ltd.
    Verified Supplier


    Buy cheap Accurate Bio-electric Large Quantum Magnetic Resonance Health Analyzers / Body Analyser product

    Brand Name:SSCH

    Model Number:GY-D05

    Place of Origin:CHINA SHENZHEN

    Large Quantum Magnetic Resonance health Analyzer We have the latest report from 41 The Quantum Health Analyzer Have 41 Reports 1 Cardiovascular and Cerebrovascular 22 Heavy Metal 2 Gastrointestinal Function 23 Basic Physical Quality 3 Liver Function 24 ...

    Shenzhen Guangyang Zhongkang Technology Co., Ltd.
    Verified Supplier


    Buy cheap 98% High Purity Bio Identical Muscle Building Peptides Sermorelin White Color product

    Brand Name:YUANYANG

    Model Number:CAS: 86168-78-7

    Place of Origin:CHINA

    ... Purity Bio-identical Growth Hormone Peptide Sermorelin (2 mg/vial) Description: Sermorelin (INN) (trade name is Geref), also known as GHRH (1-29), is a growth hormone- releasing hormone (GHRH) analogue used as a diagnostic agent...

    Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier


    Buy cheap Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 product

    Brand Name:Shuangbojie


    Place of Origin:China

    ...Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier


    Buy cheap Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage product

    Brand Name:Sendi


    Place of Origin:China

    ...Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier


    Buy cheap 2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder product

    Brand Name:Zhenxiang

    Model Number:CAS: 86168-78-7

    Place of Origin:CHINA

    2mg/vial Sermorelin Acetate CAS: 86168-78-7 Peptide Steroid Hormones White Lyophilized Powder Quick Detail; Alias:Sermorelin Acetate Hydrate CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.96 Purity: 99% Specification: 2mg/vial Appearance: White Lyophilized ...

    Changsha Zhenxiang Biotechnology Co., Ltd.
    Verified Supplier


    Buy cheap 18 In 1 Professional Multifunction Beauty Salon Equipment In Acne And Scar Treatment product

    Place of Origin:China, Guangzhou

    Brand Name:Boldness

    Model Number:QZ-9000H

    18 In 1 Professional Multifunction Beauty Salon Equipment In Acne And Scar Treatment 1. Ultrasonic 2. High frequency 3. Spot removal 4. Vacuum blackhead 5. Spray 6. Hot facial steamer 7. Magnifying lamp 8. Skin scrubber 9. Galvanic in 10. Galvanic out 11....

    Guangzhou Baolizi Body Beauty Equipment Factory
    Verified Supplier


    Buy cheap elisa food safety diagnostic equipment product

    Brand Name:Addcare

    Model Number:ELISA 600

    Place of Origin:CHINA

    ♦ High speed and throughput ♦ Convincing performance ♦ Benchtop and cabinet design ♦ Flexible workbench setup ♦ Intuitive and flexible software ♦ Cost-effective Automated Elisa workstation---can test HBV,HIV, HCV ,TP etc, used for test human ...

    Yantai Addcare Bio-Tech Limited Company
    Active Member


    Buy cheap 38 reportes With Massager Slipper Healthcare Diagnostic Equipment Quantum Analyzes Quantum Magnetic Resonance Analyzer product

    Place of Origin:China

    Brand Name:OEM ODM

    Model Number:AH-Q4

    ... provide OEM and other customization. ( 38 reportes With Massager Slipper Healthcare Diagnostic Equipment Quantum Analyzes Quantum Magnetic Resonance Analyzer 8 Language Model:AH-Q4 Quick Detail: quantum magnetic...

    shenzhen huge industry limited
    Site Member


    Buy cheap Quantum bio-electric body analyzer FHD-2004FD French version product

    Place of Origin:China

    Brand Name:FHD

    Model Number:FHD-2004FD

    ... years, a number of medical and computer experts invented quantum health monitor. 2) Comprehensive - Our quantum health diagnostic instrument can make a comprehensive examination to human body. After the test, 16 health reports can...

    Shenzhen Bersun Electronic Co.,Ltd
    Site Member


    Buy cheap English 3.9.6 Version quantum resonance magnetic analyzer software crack quantum diagnostics malaysia model AH-Q12 product

    Place of Origin:China

    Brand Name:HUGE OEM ODM

    Model Number:AH-Q12

    ...English 3.9.6 Version quantum resonance magnetic analyzer software crack quantum diagnostics malaysia model AH-Q12 resonance Description: No. Language version Reports Quantity 01 English version 41 ...

    Please input your companyname!
    Site Member


    Buy cheap Smds Iii Adm-300a Automotive Diagnostic Software For Laptop Automotive Diagnostic Code Reader product

    Place of Origin:shen zhen ,china

    Brand Name:Star

    ... Adm-300a Automotive Diagnostic Software For Laptop Automotive Diagnostic Code Reader Specifications automotive diagnostic software for laptop SMDS III ADM-300 1.odometer adjusting 2.Airbag resetting 3.IMMO reading automotive diagnostic software for laptop...

    Shenzhen Star Automotive Technology Co., Ltd.
    Active Member


    Buy cheap Bio-Electric Body Quantum Health Analyzer With English Thai Version product

    Place of Origin:Guangzhou city, China

    Brand Name:Boru

    ...Bio-Electric Body Quantum Health Analyzer With English Thai Version Quick Detail: Quantum Magnetic Resonance Analyzer ...

    Guangzhou Boru Electronic Technology Co.,Ltd
    Active Member


    Buy cheap Portable personal home use electronic Bio-feedback stimulator product

    Place of Origin:Shanghai

    Brand Name:NCC

    Model Number:NTS-2000-BIO

    ...About us: We are a professional manufacturer which produce many kinds of electrophysiological diagnostic and rehabilitation equipments for more than 15 years history in China. Our products cover EEG/...

    NCC Medical Co.,Ltd
    Active Member


    Buy cheap lipo laser bio slim / lipo laser lipolysis slimming machine dm-909 product

    Place of Origin:Beijing ,China

    Brand Name:Nubway

    Model Number:PZ900

    ... bio slim lipo laser lipolysis slimming machine dm-909 Product Description technical Parameter : Wavelength 650nm Energy Output 34*100 mw Main Power output 220v or 110v/50Hz-60Hz Safety On Board Diagnostics...

    Beijing Nubway S & T Co, Ltd
    Site Member


    Buy cheap Portable Quantum Resonance Magnetic Body Health Analyzer Bio-Electric product

    Place of Origin:china

    Brand Name:guangdong

    Model Number:GY-D03

    ...Portable Quantum Resonance Magnetic Body Health Analyzer Bio-Electric CustomAttributes: Name:quantum resonance magnetic analyzer Feature: Professional,Comprehensive,Accurate,Ahead,Simple,Convenient,Economic,...

    Shenzhen Guangyang Zhongkang Technology Co., Ltd.
    Active Member


    Buy cheap 8d nls Meridian Health body Diagnostic Device Sub-health Early-warning system product

    Place of Origin:china

    Brand Name:ssch

    Model Number:GY-518D

    .... 5. More advanced, has a large database 6. Defines in more detail the diagnoses. 7. The best pre-clinical diagnostic device 8. The most practical model for Clinical version 9. It can detect all the problem

    Shenzhen Guangyangzhongkang Technology Co., Ltd.
    Site Member


    Buy cheap Quantum bio-electric body analyzer FHD-2004FD French version product

    Place of Origin:China

    Brand Name:FHD

    Model Number:FHD-2004FD

    ... years, a number of medical and computer experts invented quantum health monitor. 2) Comprehensive - Our quantum health diagnostic instrument can make a comprehensive examination to human body. After the test, 16 health reports can...

    Shenzhen Bersun Electronic Co.,Ltd
    Site Member


    Go to Page
    Inquiry Cart 0